Anti RIDA pAb (ATL-HPA023489 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023489-100

Protein Description: reactive intermediate imine deaminase A homolog
Gene Name: RIDA
Alternative Gene Name: HRSP12, P14.5, PSP, UK114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022323: 81%, ENSRNOG00000005437: 89%
Entrez Gene ID: 10247
Uniprot ID: P52758
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGP
• Gene Sequence: GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGP
• Gene ID - Mouse: ENSMUSG00000022323
• Gene ID - Rat: ENSRNOG00000005437
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RIDA pAb (ATL-HPA023489 w/enhanced validation) – 2 Found

Dhawan, Latika; Liu, Bin; Pytlak, Allison; Kulshrestha, Satyarth; Blaxall, Burns C; Taubman, Mark B. Y-box binding protein 1 and RNase UK114 mediate monocyte chemoattractant protein 1 mRNA stability in vascular smooth muscle cells. Molecular And Cellular Biology. 2012;32(18):3768-75. 

Siculella, Luisa; Giannotti, Laura; Di Chiara Stanca, Benedetta; Calcagnile, Matteo; Rochira, Alessio; Stanca, Eleonora; Alifano, Pietro; Damiano, Fabrizio. Evidence for a Negative Correlation between Human Reactive Enamine-Imine Intermediate Deaminase A (RIDA) Activity and Cell Proliferation Rate: Role of Lysine Succinylation of RIDA. International Journal Of Molecular Sciences. 2021;22(8)