Anti RIDA pAb (ATL-HPA022856 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022856-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RIDA
Alternative Gene Name: HRSP12, P14.5, PSP, UK114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022323: 86%, ENSRNOG00000005437: 88%
Entrez Gene ID: 10247
Uniprot ID: P52758
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAA |
| Gene Sequence | MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAA |
| Gene ID - Mouse | ENSMUSG00000022323 |
| Gene ID - Rat | ENSRNOG00000005437 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RIDA pAb (ATL-HPA022856 w/enhanced validation) | |
| Datasheet | Anti RIDA pAb (ATL-HPA022856 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RIDA pAb (ATL-HPA022856 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RIDA pAb (ATL-HPA022856 w/enhanced validation) | |
| Datasheet | Anti RIDA pAb (ATL-HPA022856 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RIDA pAb (ATL-HPA022856 w/enhanced validation) |
| Citations for Anti RIDA pAb (ATL-HPA022856 w/enhanced validation) – 1 Found |
| Dhawan, Latika; Liu, Bin; Pytlak, Allison; Kulshrestha, Satyarth; Blaxall, Burns C; Taubman, Mark B. Y-box binding protein 1 and RNase UK114 mediate monocyte chemoattractant protein 1 mRNA stability in vascular smooth muscle cells. Molecular And Cellular Biology. 2012;32(18):3768-75. PubMed |