Anti RC3H1 pAb (ATL-HPA027434)

Atlas Antibodies

Catalog No.: ATL-HPA027434-25

Protein Description: ring finger and CCCH-type domains 1
Gene Name: RC3H1
Alternative Gene Name: KIAA2025, RNF198, roquin, RP5-1198E17.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040423: 89%, ENSRNOG00000009196: 32%
Entrez Gene ID: 149041
Uniprot ID: Q5TC82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG
• Gene Sequence: AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG
• Gene ID - Mouse: ENSMUSG00000040423
• Gene ID - Rat: ENSRNOG00000009196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.