Anti RAB34 pAb (ATL-HPA021366)

Atlas Antibodies

Catalog No.: ATL-HPA021366-25

Protein Description: RAB34, member RAS oncogene family
Gene Name: RAB34
Alternative Gene Name: RAB39, RAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002059: 93%, ENSRNOG00000023375: 93%
Entrez Gene ID: 83871
Uniprot ID: Q9BZG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
• Gene Sequence: GENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
• Gene ID - Mouse: ENSMUSG00000002059
• Gene ID - Rat: ENSRNOG00000023375
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.