Anti RAB34 pAb (ATL-HPA021366)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021366-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RAB34
Alternative Gene Name: RAB39, RAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002059: 93%, ENSRNOG00000023375: 93%
Entrez Gene ID: 83871
Uniprot ID: Q9BZG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP |
| Gene Sequence | GENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP |
| Gene ID - Mouse | ENSMUSG00000002059 |
| Gene ID - Rat | ENSRNOG00000023375 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAB34 pAb (ATL-HPA021366) | |
| Datasheet | Anti RAB34 pAb (ATL-HPA021366) Datasheet (External Link) |
| Vendor Page | Anti RAB34 pAb (ATL-HPA021366) at Atlas Antibodies |
| Documents & Links for Anti RAB34 pAb (ATL-HPA021366) | |
| Datasheet | Anti RAB34 pAb (ATL-HPA021366) Datasheet (External Link) |
| Vendor Page | Anti RAB34 pAb (ATL-HPA021366) |