Anti R3HCC1 pAb (ATL-HPA023073)

Atlas Antibodies

Catalog No.: ATL-HPA023073-25

Protein Description: R3H domain and coiled-coil containing 1
Gene Name: R3HCC1
Alternative Gene Name: DKFZp564N123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034194: 49%, ENSRNOG00000016777: 53%
Entrez Gene ID: 203069
Uniprot ID: Q9Y3T6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQPLYVPRVLRKQEEWGLTSTSVLKREAPAGRDPEEPGDVGAGDPNSDQGLPVLMTQGTEDLKGPGQRCENEPLLD
• Gene Sequence: DQPLYVPRVLRKQEEWGLTSTSVLKREAPAGRDPEEPGDVGAGDPNSDQGLPVLMTQGTEDLKGPGQRCENEPLLD
• Gene ID - Mouse: ENSMUSG00000034194
• Gene ID - Rat: ENSRNOG00000016777
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.