Anti PUM2 pAb (ATL-HPA030316)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030316-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PUM2
Alternative Gene Name: KIAA0235, PUMH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020594: 93%, ENSRNOG00000006180: 93%
Entrez Gene ID: 23369
Uniprot ID: Q8TB72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQF |
| Gene Sequence | ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQF |
| Gene ID - Mouse | ENSMUSG00000020594 |
| Gene ID - Rat | ENSRNOG00000006180 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PUM2 pAb (ATL-HPA030316) | |
| Datasheet | Anti PUM2 pAb (ATL-HPA030316) Datasheet (External Link) |
| Vendor Page | Anti PUM2 pAb (ATL-HPA030316) at Atlas Antibodies |
| Documents & Links for Anti PUM2 pAb (ATL-HPA030316) | |
| Datasheet | Anti PUM2 pAb (ATL-HPA030316) Datasheet (External Link) |
| Vendor Page | Anti PUM2 pAb (ATL-HPA030316) |