Anti PUM2 pAb (ATL-HPA030316)

Atlas Antibodies

Catalog No.: ATL-HPA030316-25

Protein Description: pumilio RNA-binding family member 2
Gene Name: PUM2
Alternative Gene Name: KIAA0235, PUMH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020594: 93%, ENSRNOG00000006180: 93%
Entrez Gene ID: 23369
Uniprot ID: Q8TB72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQF
• Gene Sequence: ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQF
• Gene ID - Mouse: ENSMUSG00000020594
• Gene ID - Rat: ENSRNOG00000006180
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.