Anti PTRHD1 pAb (ATL-HPA019951)

Atlas Antibodies

Catalog No.: ATL-HPA019951-25

Protein Description: peptidyl-tRNA hydrolase domain containing 1
Gene Name: PTRHD1
Alternative Gene Name: C2orf79, LOC391356
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096199: 95%, ENSRNOG00000004059: 94%
Entrez Gene ID: 391356
Uniprot ID: Q6GMV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
• Gene Sequence: GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
• Gene ID - Mouse: ENSMUSG00000096199
• Gene ID - Rat: ENSRNOG00000004059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.