Anti PTPRN pAb (ATL-HPA007179 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007179-25

Protein Description: protein tyrosine phosphatase, receptor type, N
Gene Name: PTPRN
Alternative Gene Name: IA-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026204: 77%, ENSRNOG00000019587: 81%
Entrez Gene ID: 5798
Uniprot ID: Q16849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
• Gene Sequence: HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
• Gene ID - Mouse: ENSMUSG00000026204
• Gene ID - Rat: ENSRNOG00000019587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTPRN pAb (ATL-HPA007179 w/enhanced validation) – 2 Found

Lindskog, Cecilia; Korsgren, Olle; Pontén, Fredrik; Eriksson, Jan W; Johansson, Lars; Danielsson, Angelika. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. Journal Of Proteomics. 2012;75(9):2611-20. 

Damond, Nicolas; Engler, Stefanie; Zanotelli, Vito R T; Schapiro, Denis; Wasserfall, Clive H; Kusmartseva, Irina; Nick, Harry S; Thorel, Fabrizio; Herrera, Pedro L; Atkinson, Mark A; Bodenmiller, Bernd. A Map of Human Type 1 Diabetes Progression by Imaging Mass Cytometry. Cell Metabolism. 2019;29(3):755-768.e5.