Anti PTPRN pAb (ATL-HPA007152)

Atlas Antibodies

Catalog No.:
ATL-HPA007152-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, receptor type, N
Gene Name: PTPRN
Alternative Gene Name: IA-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026204: 77%, ENSRNOG00000019587: 81%
Entrez Gene ID: 5798
Uniprot ID: Q16849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
Gene Sequence HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
Gene ID - Mouse ENSMUSG00000026204
Gene ID - Rat ENSRNOG00000019587
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTPRN pAb (ATL-HPA007152)
Datasheet Anti PTPRN pAb (ATL-HPA007152) Datasheet (External Link)
Vendor Page Anti PTPRN pAb (ATL-HPA007152) at Atlas Antibodies

Documents & Links for Anti PTPRN pAb (ATL-HPA007152)
Datasheet Anti PTPRN pAb (ATL-HPA007152) Datasheet (External Link)
Vendor Page Anti PTPRN pAb (ATL-HPA007152)