Anti PRKAG2 pAb (ATL-HPA004246)

Atlas Antibodies

Catalog No.: ATL-HPA004246-25

Protein Description: protein kinase, AMP-activated, gamma 2 non-catalytic subunit
Gene Name: PRKAG2
Alternative Gene Name: AAKG, AAKG2, CMH6, H91620p, WPWS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028944: 83%, ENSRNOG00000009085: 84%
Entrez Gene ID: 51422
Uniprot ID: Q9UGJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHK
• Gene Sequence: STPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHK
• Gene ID - Mouse: ENSMUSG00000028944
• Gene ID - Rat: ENSRNOG00000009085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRKAG2 pAb (ATL-HPA004246) – 2 Found

Martiáñez, Tània; Francès, Sílvia; López, José M. Generation of digital responses in stress sensors. The Journal Of Biological Chemistry. 2009;284(36):23902-11. 

Pinter, Katalin; Jefferson, Andrew; Czibik, Gabor; Watkins, Hugh; Redwood, Charles. Subunit composition of AMPK trimers present in the cytokinetic apparatus: Implications for drug target identification. Cell Cycle (Georgetown, Tex.). 2012;11(5):917-21.