Anti PPP1R3B pAb (ATL-HPA028731)

Atlas Antibodies

Catalog No.:
ATL-HPA028731-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein phosphatase 1, regulatory subunit 3B
Gene Name: PPP1R3B
Alternative Gene Name: FLJ14005, GL, PPP1R4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046794: 83%, ENSRNOG00000011474: 88%
Entrez Gene ID: 79660
Uniprot ID: Q86XI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLF
Gene Sequence DRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLF
Gene ID - Mouse ENSMUSG00000046794
Gene ID - Rat ENSRNOG00000011474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPP1R3B pAb (ATL-HPA028731)
Datasheet Anti PPP1R3B pAb (ATL-HPA028731) Datasheet (External Link)
Vendor Page Anti PPP1R3B pAb (ATL-HPA028731) at Atlas Antibodies

Documents & Links for Anti PPP1R3B pAb (ATL-HPA028731)
Datasheet Anti PPP1R3B pAb (ATL-HPA028731) Datasheet (External Link)
Vendor Page Anti PPP1R3B pAb (ATL-HPA028731)