Anti PNPLA4 pAb (ATL-HPA003656)

Atlas Antibodies

Catalog No.:
ATL-HPA003656-100
Immunohistochemical staining of human small intestine shows moderate cytoplasmic and nuclear positivity in glandular cells.
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: patatin-like phospholipase domain containing 4
Gene Name: PNPLA4
Alternative Gene Name: DXS1283E, GS2, iPLA2eta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025509: 35%, ENSRNOG00000026157: 63%
Entrez Gene ID: 8228
Uniprot ID: P41247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLD
Gene Sequence QFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLD
Gene ID - Mouse ENSMUSG00000025509
Gene ID - Rat ENSRNOG00000026157
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PNPLA4 pAb (ATL-HPA003656)
Datasheet Anti PNPLA4 pAb (ATL-HPA003656) Datasheet (External Link)
Vendor Page Anti PNPLA4 pAb (ATL-HPA003656) at Atlas Antibodies

Documents & Links for Anti PNPLA4 pAb (ATL-HPA003656)
Datasheet Anti PNPLA4 pAb (ATL-HPA003656) Datasheet (External Link)
Vendor Page Anti PNPLA4 pAb (ATL-HPA003656)
!