Anti PITPNC1 pAb (ATL-HPA031250)

Atlas Antibodies

Catalog No.: ATL-HPA031250-25

Protein Description: phosphatidylinositol transfer protein, cytoplasmic 1
Gene Name: PITPNC1
Alternative Gene Name: RDGB-BETA, RDGBB, RDGBB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040430: 100%, ENSRNOG00000018553: 48%
Entrez Gene ID: 26207
Uniprot ID: Q9UKF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTI
• Gene Sequence: TVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTI
• Gene ID - Mouse: ENSMUSG00000040430
• Gene ID - Rat: ENSRNOG00000018553
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.