Anti PHF20L1 pAb (ATL-HPA028417)

Atlas Antibodies

Catalog No.:
ATL-HPA028417-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 20-like 1
Gene Name: PHF20L1
Alternative Gene Name: CGI-72, FLJ13649, FLJ21615, MGC64923, TDRD20B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072501: 83%, ENSRNOG00000046527: 82%
Entrez Gene ID: 51105
Uniprot ID: A8MW92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EETSTCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNKITGLLASKAVGVDGAEKKEDYNETA
Gene Sequence EETSTCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNKITGLLASKAVGVDGAEKKEDYNETA
Gene ID - Mouse ENSMUSG00000072501
Gene ID - Rat ENSRNOG00000046527
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHF20L1 pAb (ATL-HPA028417)
Datasheet Anti PHF20L1 pAb (ATL-HPA028417) Datasheet (External Link)
Vendor Page Anti PHF20L1 pAb (ATL-HPA028417) at Atlas Antibodies

Documents & Links for Anti PHF20L1 pAb (ATL-HPA028417)
Datasheet Anti PHF20L1 pAb (ATL-HPA028417) Datasheet (External Link)
Vendor Page Anti PHF20L1 pAb (ATL-HPA028417)
Citations for Anti PHF20L1 pAb (ATL-HPA028417) – 10 Found
Jiang, Yuanyuan; Liu, Lanxin; Shan, Wenqi; Yang, Zeng-Quan. An integrated genomic analysis of Tudor domain-containing proteins identifies PHD finger protein 20-like 1 (PHF20L1) as a candidate oncogene in breast cancer. Molecular Oncology. 2016;10(2):292-302.  PubMed
Carr, Simon M; Munro, Shonagh; Sagum, Cari A; Fedorov, Oleg; Bedford, Mark T; La Thangue, Nicholas B. Tudor-domain protein PHF20L1 reads lysine methylated retinoblastoma tumour suppressor protein. Cell Death And Differentiation. 2017;24(12):2139-2149.  PubMed
Zhang, Chunxiao; Hoang, Nam; Leng, Feng; Saxena, Lovely; Lee, Logan; Alejo, Salvador; Qi, Dandan; Khal, Anthony; Sun, Hong; Lu, Fei; Zhang, Hui. LSD1 demethylase and the methyl-binding protein PHF20L1 prevent SET7 methyltransferase-dependent proteolysis of the stem-cell protein SOX2. The Journal Of Biological Chemistry. 2018;293(10):3663-3674.  PubMed
Leng, Feng; Yu, Jiekai; Zhang, Chunxiao; Alejo, Salvador; Hoang, Nam; Sun, Hong; Lu, Fei; Zhang, Hui. Methylated DNMT1 and E2F1 are targeted for proteolysis by L3MBTL3 and CRL4(DCAF5) ubiquitin ligase. Nature Communications. 2018;9(1):1641.  PubMed
Alberto-Aguilar, Dulce Rosario; Hernández-Ramírez, Verónica Ivonne; Osorio-Trujillo, Juan Carlos; Gallardo-Rincón, Dolores; Toledo-Leyva, Alfredo; Talamás-Rohana, Patricia. PHD finger protein 20-like protein 1 (PHF20L1) in ovarian cancer: from its overexpression in tissue to its upregulation by the ascites microenvironment. Cancer Cell International. 2022;22(1):6.  PubMed
Estève, Pierre-Olivier; Terragni, Jolyon; Deepti, Kanneganti; Chin, Hang Gyeong; Dai, Nan; Espejo, Alexsandra; Corrêa, Ivan R Jr; Bedford, Mark T; Pradhan, Sriharsa. Methyllysine reader plant homeodomain (PHD) finger protein 20-like 1 (PHF20L1) antagonizes DNA (cytosine-5) methyltransferase 1 (DNMT1) proteasomal degradation. The Journal Of Biological Chemistry. 2014;289(12):8277-87.  PubMed
Zhang, Chunxiao; Leng, Feng; Saxena, Lovely; Hoang, Nam; Yu, Jiekai; Alejo, Salvador; Lee, Logan; Qi, Dandan; Lu, Fei; Sun, Hong; Zhang, Hui. Proteolysis of methylated SOX2 protein is regulated by L3MBTL3 and CRL4(DCAF5) ubiquitin ligase. The Journal Of Biological Chemistry. 2019;294(2):476-489.  PubMed
Alberto-Aguilar, Dulce Rosario; Hernández-Ramírez, Verónica Ivonne; Osorio-Trujillo, Juan Carlos; Gallardo-Rincón, Dolores; Toledo-Leyva, Alfredo; Talamás-Rohana, Patricia. Ascites from Ovarian Cancer Induces Novel Fucosylated Proteins. Cancer Microenvironment : Official Journal Of The International Cancer Microenvironment Society. 2019;12(2-3):181-195.  PubMed
Hou, Yongqiang; Liu, Wei; Yi, Xianfu; Yang, Yang; Su, Dongxue; Huang, Wei; Yu, Hefen; Teng, Xu; Yang, Ying; Feng, Wei; Zhang, Tao; Gao, Jie; Zhang, Kai; Qiu, Rongfang; Wang, Yan. PHF20L1 as a H3K27me2 reader coordinates with transcriptional repressors to promote breast tumorigenesis. Science Advances. 2020;6(16):eaaz0356.  PubMed
Van, Hieu T; Harkins, Peter R; Patel, Avni; Jain, Abhinav K; Lu, Yue; Bedford, Mark T; Santos, Margarida A. Methyl-lysine readers PHF20 and PHF20L1 define two distinct gene expression-regulating NSL complexes. The Journal Of Biological Chemistry. 2022;298(3):101588.  PubMed