Anti PFDN1 pAb (ATL-HPA006499)

Atlas Antibodies

Catalog No.: ATL-HPA006499-25

Protein Description: prefoldin subunit 1
Gene Name: PFDN1
Alternative Gene Name: PFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024346: 98%, ENSRNOG00000018653: 98%
Entrez Gene ID: 5201
Uniprot ID: O60925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRA
• Gene Sequence: ELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRA
• Gene ID - Mouse: ENSMUSG00000024346
• Gene ID - Rat: ENSRNOG00000018653
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PFDN1 pAb (ATL-HPA006499) – 1 Found

Miyazawa, Makoto; Tashiro, Erika; Kitaura, Hirotake; Maita, Hiroshi; Suto, Hiroo; Iguchi-Ariga, Sanae M M; Ariga, Hiroyoshi. Prefoldin subunits are protected from ubiquitin-proteasome system-mediated degradation by forming complex with other constituent subunits. The Journal Of Biological Chemistry. 2011;286(22):19191-203.