Anti PEBP4 pAb (ATL-HPA025064)

Atlas Antibodies

Catalog No.: ATL-HPA025064-25

Protein Description: phosphatidylethanolamine-binding protein 4
Gene Name: PEBP4
Alternative Gene Name: CORK1, hPEBP4, MGC22776
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039542: 29%, ENSRNOG00000031890: 31%
Entrez Gene ID: 157310
Uniprot ID: Q96S96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHK
• Gene Sequence: EGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHK
• Gene ID - Mouse: ENSMUSG00000039542
• Gene ID - Rat: ENSRNOG00000031890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PEBP4 pAb (ATL-HPA025064) – 1 Found

Kim, Il-Jin; Quigley, David; To, Minh D; Pham, Patrick; Lin, Kevin; Jo, Brian; Jen, Kuang-Yu; Raz, Dan; Kim, Jae; Mao, Jian-Hua; Jablons, David; Balmain, Allan. Rewiring of human lung cell lineage and mitotic networks in lung adenocarcinomas. Nature Communications. 4( 23591868):1701.