Anti PCDHB2 pAb (ATL-HPA007548 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007548-25

Protein Description: protocadherin beta 2
Gene Name: PCDHB2
Alternative Gene Name: PCDH-BETA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051599: 73%, ENSRNOG00000039476: 77%
Entrez Gene ID:
Uniprot ID: Q9Y5E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLDGIILPQLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVV
• Gene Sequence: ESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLDGIILPQLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVV
• Gene ID - Mouse: ENSMUSG00000051599
• Gene ID - Rat: ENSRNOG00000039476
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.