Anti PARP11 pAb (ATL-HPA026895)

Atlas Antibodies

Catalog No.: ATL-HPA026895-25

Protein Description: poly (ADP-ribose) polymerase family, member 11
Gene Name: PARP11
Alternative Gene Name: C12orf6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037997: 91%, ENSRNOG00000060689: 91%
Entrez Gene ID: 57097
Uniprot ID: Q9NR21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRK
• Gene Sequence: SISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRK
• Gene ID - Mouse: ENSMUSG00000037997
• Gene ID - Rat: ENSRNOG00000060689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.