Anti PARP11 pAb (ATL-HPA026895)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026895-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PARP11
Alternative Gene Name: C12orf6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037997: 91%, ENSRNOG00000060689: 91%
Entrez Gene ID: 57097
Uniprot ID: Q9NR21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRK |
| Gene Sequence | SISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRK |
| Gene ID - Mouse | ENSMUSG00000037997 |
| Gene ID - Rat | ENSRNOG00000060689 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PARP11 pAb (ATL-HPA026895) | |
| Datasheet | Anti PARP11 pAb (ATL-HPA026895) Datasheet (External Link) |
| Vendor Page | Anti PARP11 pAb (ATL-HPA026895) at Atlas Antibodies |
| Documents & Links for Anti PARP11 pAb (ATL-HPA026895) | |
| Datasheet | Anti PARP11 pAb (ATL-HPA026895) Datasheet (External Link) |
| Vendor Page | Anti PARP11 pAb (ATL-HPA026895) |