Anti OSTF1 pAb (ATL-HPA020514)

Atlas Antibodies

Catalog No.: ATL-HPA020514-25

Protein Description: osteoclast stimulating factor 1
Gene Name: OSTF1
Alternative Gene Name: bA235O14.1, OSF, SH3P2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024725: 97%, ENSRNOG00000012156: 97%
Entrez Gene ID: 26578
Uniprot ID: Q92882
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNP
• Gene Sequence: MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNP
• Gene ID - Mouse: ENSMUSG00000024725
• Gene ID - Rat: ENSRNOG00000012156
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OSTF1 pAb (ATL-HPA020514) – 1 Found

Vermeren, Matthieu; Lyraki, Rodanthi; Wani, Sachin; Airik, Rannar; Albagha, Omar; Mort, Richard; Hildebrandt, Friedhelm; Hurd, Toby. Osteoclast stimulation factor 1 (Ostf1) KNOCKOUT increases trabecular bone mass in mice. Mammalian Genome : Official Journal Of The International Mammalian Genome Society. 2017;28(11-12):498-514.