Anti OSBP2 pAb (ATL-HPA021514)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021514-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: OSBP2
Alternative Gene Name: KIAA1664, ORP-4, ORP4, OSBPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020435: 87%, ENSRNOG00000019645: 87%
Entrez Gene ID: 23762
Uniprot ID: Q969R2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITV |
| Gene Sequence | SRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITV |
| Gene ID - Mouse | ENSMUSG00000020435 |
| Gene ID - Rat | ENSRNOG00000019645 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OSBP2 pAb (ATL-HPA021514) | |
| Datasheet | Anti OSBP2 pAb (ATL-HPA021514) Datasheet (External Link) |
| Vendor Page | Anti OSBP2 pAb (ATL-HPA021514) at Atlas Antibodies |
| Documents & Links for Anti OSBP2 pAb (ATL-HPA021514) | |
| Datasheet | Anti OSBP2 pAb (ATL-HPA021514) Datasheet (External Link) |
| Vendor Page | Anti OSBP2 pAb (ATL-HPA021514) |
| Citations for Anti OSBP2 pAb (ATL-HPA021514) – 2 Found |
| Li, Ji-Wei; Xiao, Yan-Lin; Lai, Chao-Feng; Lou, Ning; Ma, Hong-Ling; Zhu, Bi-Ying; Zhong, Wen-Bin; Yan, Dao-Guang. Oxysterol-binding protein-related protein 4L promotes cell proliferation by sustaining intracellular Ca2+ homeostasis in cervical carcinoma cell lines. Oncotarget. 2016;7(40):65849-65861. PubMed |
| Zhong, Wenbin; Lin, Weize; Yang, Yingjie; Chen, Dan; Cao, Xiuye; Xu, Mengyang; Pan, Guoping; Chen, Huanzhao; Zheng, Jie; Feng, Xiaoqin; Yang, Li Hua; Lai, Chaofeng; Olkkonen, Vesa M; Xu, Jun; Cui, Shuzhong; Yan, Daoguang. An acquired phosphatidylinositol 4-phosphate transport initiates T-cell deterioration and leukemogenesis. Nature Communications. 2022;13(1):4390. PubMed |