Anti OPALIN pAb (ATL-HPA014372)

Atlas Antibodies

Catalog No.: ATL-HPA014372-25

Protein Description: oligodendrocytic myelin paranodal and inner loop protein
Gene Name: OPALIN
Alternative Gene Name: HTMP10, TMEM10, TMP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050121: 72%, ENSRNOG00000022386: 75%
Entrez Gene ID: 93377
Uniprot ID: Q96PE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE
• Gene Sequence: RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE
• Gene ID - Mouse: ENSMUSG00000050121
• Gene ID - Rat: ENSRNOG00000022386
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OPALIN pAb (ATL-HPA014372) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.