Anti NUB1 pAb (ATL-HPA021220)

Atlas Antibodies

Catalog No.:
ATL-HPA021220-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: negative regulator of ubiquitin-like proteins 1
Gene Name: NUB1
Alternative Gene Name: BS4, NYREN18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028954: 84%, ENSRNOG00000009282: 86%
Entrez Gene ID: 51667
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEE
Gene Sequence DNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEE
Gene ID - Mouse ENSMUSG00000028954
Gene ID - Rat ENSRNOG00000009282
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUB1 pAb (ATL-HPA021220)
Datasheet Anti NUB1 pAb (ATL-HPA021220) Datasheet (External Link)
Vendor Page Anti NUB1 pAb (ATL-HPA021220) at Atlas Antibodies

Documents & Links for Anti NUB1 pAb (ATL-HPA021220)
Datasheet Anti NUB1 pAb (ATL-HPA021220) Datasheet (External Link)
Vendor Page Anti NUB1 pAb (ATL-HPA021220)