Anti NOL12 pAb (ATL-HPA003547)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003547-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NOL12
Alternative Gene Name: MGC3731, Nop25, RRP17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033099: 88%, ENSRNOG00000010209: 86%
Entrez Gene ID: 79159
Uniprot ID: Q9UGY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKAR |
| Gene Sequence | HQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKAR |
| Gene ID - Mouse | ENSMUSG00000033099 |
| Gene ID - Rat | ENSRNOG00000010209 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NOL12 pAb (ATL-HPA003547) | |
| Datasheet | Anti NOL12 pAb (ATL-HPA003547) Datasheet (External Link) |
| Vendor Page | Anti NOL12 pAb (ATL-HPA003547) at Atlas Antibodies |
| Documents & Links for Anti NOL12 pAb (ATL-HPA003547) | |
| Datasheet | Anti NOL12 pAb (ATL-HPA003547) Datasheet (External Link) |
| Vendor Page | Anti NOL12 pAb (ATL-HPA003547) |