Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008789-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NFATC2
Alternative Gene Name: NF-ATP, NFAT1, NFATp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027544: 81%, ENSRNOG00000012175: 80%
Entrez Gene ID: 4773
Uniprot ID: Q13469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV |
| Gene Sequence | DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV |
| Gene ID - Mouse | ENSMUSG00000027544 |
| Gene ID - Rat | ENSRNOG00000012175 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation) | |
| Datasheet | Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation) | |
| Datasheet | Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation) |
| Citations for Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation) – 5 Found |
| Quang, C Tran; Leboucher, S; Passaro, D; Fuhrmann, L; Nourieh, M; Vincent-Salomon, A; Ghysdael, J. The calcineurin/NFAT pathway is activated in diagnostic breast cancer cases and is essential to survival and metastasis of mammary cancer cells. Cell Death & Disease. 2015;6(2):e1658. PubMed |
| Scanlon, Christina Springstead; Banerjee, Rajat; Inglehart, Ronald C; Liu, Min; Russo, Nickole; Hariharan, Amirtha; van Tubergen, Elizabeth A; Corson, Sara L; Asangani, Irfan A; Mistretta, Charlotte M; Chinnaiyan, Arul M; D'Silva, Nisha J. Galanin modulates the neural niche to favour perineural invasion in head and neck cancer. Nature Communications. 2015;6( 25917569):6885. PubMed |
| Weider, Matthias; Starost, Laura Julia; Groll, Katharina; Küspert, Melanie; Sock, Elisabeth; Wedel, Miriam; Fröb, Franziska; Schmitt, Christian; Baroti, Tina; Hartwig, Anna C; Hillgärtner, Simone; Piefke, Sandra; Fadler, Tanja; Ehrlich, Marc; Ehlert, Corinna; Stehling, Martin; Albrecht, Stefanie; Jabali, Ammar; Schöler, Hans R; Winkler, Jürgen; Kuhlmann, Tanja; Wegner, Michael. Nfat/calcineurin signaling promotes oligodendrocyte differentiation and myelination by transcription factor network tuning. Nature Communications. 2018;9(1):899. PubMed |
| Joshi, Rubin Narayan; Stadler, Charlotte; Lehmann, Robert; Lehtiö, Janne; Tegnér, Jesper; Schmidt, Angelika; Vesterlund, Mattias. TcellSubC: An Atlas of the Subcellular Proteome of Human T Cells. Frontiers In Immunology. 10( 31849937):2708. PubMed |
| Duraiswamy, Jaikumar; Turrini, Riccardo; Minasyan, Aspram; Barras, David; Crespo, Isaac; Grimm, Alizée J; Casado, Julia; Genolet, Raphael; Benedetti, Fabrizio; Wicky, Alexandre; Ioannidou, Kalliopi; Castro, Wilson; Neal, Christopher; Moriot, Amandine; Renaud-Tissot, Stéphanie; Anstett, Victor; Fahr, Noémie; Tanyi, Janos L; Eiva, Monika A; Jacobson, Connor A; Montone, Kathleen T; Westergaard, Marie Christine Wulff; Svane, Inge Marie; Kandalaft, Lana E; Delorenzi, Mauro; Sorger, Peter K; Färkkilä, Anniina; Michielin, Olivier; Zoete, Vincent; Carmona, Santiago J; Foukas, Periklis G; Powell, Daniel J Jr; Rusakiewicz, Sylvie; Doucey, Marie-Agnès; Dangaj Laniti, Denarda; Coukos, George. Myeloid antigen-presenting cell niches sustain antitumor T cells and license PD-1 blockade via CD28 costimulation. Cancer Cell. 2021;39(12):1623-1642.e20. PubMed |