Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008789-25

Protein Description: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Gene Name: NFATC2
Alternative Gene Name: NF-ATP, NFAT1, NFATp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027544: 81%, ENSRNOG00000012175: 80%
Entrez Gene ID: 4773
Uniprot ID: Q13469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
• Gene Sequence: DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
• Gene ID - Mouse: ENSMUSG00000027544
• Gene ID - Rat: ENSRNOG00000012175
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NFATC2 pAb (ATL-HPA008789 w/enhanced validation) – 5 Found

Quang, C Tran; Leboucher, S; Passaro, D; Fuhrmann, L; Nourieh, M; Vincent-Salomon, A; Ghysdael, J. The calcineurin/NFAT pathway is activated in diagnostic breast cancer cases and is essential to survival and metastasis of mammary cancer cells. Cell Death & Disease. 2015;6(2):e1658. 

Scanlon, Christina Springstead; Banerjee, Rajat; Inglehart, Ronald C; Liu, Min; Russo, Nickole; Hariharan, Amirtha; van Tubergen, Elizabeth A; Corson, Sara L; Asangani, Irfan A; Mistretta, Charlotte M; Chinnaiyan, Arul M; D'Silva, Nisha J. Galanin modulates the neural niche to favour perineural invasion in head and neck cancer. Nature Communications. 2015;6( 25917569):6885. 

Weider, Matthias; Starost, Laura Julia; Groll, Katharina; Küspert, Melanie; Sock, Elisabeth; Wedel, Miriam; Fröb, Franziska; Schmitt, Christian; Baroti, Tina; Hartwig, Anna C; Hillgärtner, Simone; Piefke, Sandra; Fadler, Tanja; Ehrlich, Marc; Ehlert, Corinna; Stehling, Martin; Albrecht, Stefanie; Jabali, Ammar; Schöler, Hans R; Winkler, Jürgen; Kuhlmann, Tanja; Wegner, Michael. Nfat/calcineurin signaling promotes oligodendrocyte differentiation and myelination by transcription factor network tuning. Nature Communications. 2018;9(1):899. 

Joshi, Rubin Narayan; Stadler, Charlotte; Lehmann, Robert; Lehtiö, Janne; Tegnér, Jesper; Schmidt, Angelika; Vesterlund, Mattias. TcellSubC: An Atlas of the Subcellular Proteome of Human T Cells. Frontiers In Immunology. 10( 31849937):2708. 

Duraiswamy, Jaikumar; Turrini, Riccardo; Minasyan, Aspram; Barras, David; Crespo, Isaac; Grimm, Alizée J; Casado, Julia; Genolet, Raphael; Benedetti, Fabrizio; Wicky, Alexandre; Ioannidou, Kalliopi; Castro, Wilson; Neal, Christopher; Moriot, Amandine; Renaud-Tissot, Stéphanie; Anstett, Victor; Fahr, Noémie; Tanyi, Janos L; Eiva, Monika A; Jacobson, Connor A; Montone, Kathleen T; Westergaard, Marie Christine Wulff; Svane, Inge Marie; Kandalaft, Lana E; Delorenzi, Mauro; Sorger, Peter K; Färkkilä, Anniina; Michielin, Olivier; Zoete, Vincent; Carmona, Santiago J; Foukas, Periklis G; Powell, Daniel J Jr; Rusakiewicz, Sylvie; Doucey, Marie-Agnès; Dangaj Laniti, Denarda; Coukos, George. Myeloid antigen-presenting cell niches sustain antitumor T cells and license PD-1 blockade via CD28 costimulation. Cancer Cell. 2021;39(12):1623-1642.e20.