Anti NENF pAb (ATL-HPA028488)

Atlas Antibodies

Catalog No.: ATL-HPA028488-25

Protein Description: neudesin neurotrophic factor
Gene Name: NENF
Alternative Gene Name: CIR2, SCIRP10, SPUF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037499: 97%, ENSRNOG00000003833: 92%
Entrez Gene ID: 29937
Uniprot ID: Q9UMX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQP
• Gene Sequence: LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQP
• Gene ID - Mouse: ENSMUSG00000037499
• Gene ID - Rat: ENSRNOG00000003833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.