Anti NENF pAb (ATL-HPA026763)

Atlas Antibodies

Catalog No.:
ATL-HPA026763-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: neudesin neurotrophic factor
Gene Name: NENF
Alternative Gene Name: CIR2, SCIRP10, SPUF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037499: 97%, ENSRNOG00000003833: 95%
Entrez Gene ID: 29937
Uniprot ID: Q9UMX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMS
Gene Sequence RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMS
Gene ID - Mouse ENSMUSG00000037499
Gene ID - Rat ENSRNOG00000003833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NENF pAb (ATL-HPA026763)
Datasheet Anti NENF pAb (ATL-HPA026763) Datasheet (External Link)
Vendor Page Anti NENF pAb (ATL-HPA026763) at Atlas Antibodies

Documents & Links for Anti NENF pAb (ATL-HPA026763)
Datasheet Anti NENF pAb (ATL-HPA026763) Datasheet (External Link)
Vendor Page Anti NENF pAb (ATL-HPA026763)