Anti NENF pAb (ATL-HPA026763)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026763-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NENF
Alternative Gene Name: CIR2, SCIRP10, SPUF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037499: 97%, ENSRNOG00000003833: 95%
Entrez Gene ID: 29937
Uniprot ID: Q9UMX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMS |
| Gene Sequence | RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMS |
| Gene ID - Mouse | ENSMUSG00000037499 |
| Gene ID - Rat | ENSRNOG00000003833 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NENF pAb (ATL-HPA026763) | |
| Datasheet | Anti NENF pAb (ATL-HPA026763) Datasheet (External Link) |
| Vendor Page | Anti NENF pAb (ATL-HPA026763) at Atlas Antibodies |
| Documents & Links for Anti NENF pAb (ATL-HPA026763) | |
| Datasheet | Anti NENF pAb (ATL-HPA026763) Datasheet (External Link) |
| Vendor Page | Anti NENF pAb (ATL-HPA026763) |