Anti NDRG4 pAb (ATL-HPA015313 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015313-25

Protein Description: NDRG family member 4
Gene Name: NDRG4
Alternative Gene Name: KIAA1180, SMAP-8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036564: 98%, ENSRNOG00000012482: 98%
Entrez Gene ID: 65009
Uniprot ID: Q9ULP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP
• Gene Sequence: RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP
• Gene ID - Mouse: ENSMUSG00000036564
• Gene ID - Rat: ENSRNOG00000012482
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NDRG4 pAb (ATL-HPA015313 w/enhanced validation) – 4 Found

Jandrey, Elisa H F; Moura, Ricardo P; Andrade, Luciana N S; Machado, Camila L; Campesato, Luiz Felipe; Leite, Katia Ramos M; Inoue, Lilian T; Asprino, Paula F; da Silva, Ana Paula M; de Barros, Alfredo Carlos S D; Carvalho, Andre; de Lima, Vladmir C; Carraro, Dirce M; Brentani, Helena P; da Cunha, Isabela W; Soares, Fernando A; Parmigiani, Raphael B; Chammas, Roger; Camargo, Anamaria A; Costa, Érico T. NDRG4 promoter hypermethylation is a mechanistic biomarker associated with metastatic progression in breast cancer patients. Npj Breast Cancer. 5( 30963110):11. 

Schilling, Stephen H; Hjelmeland, Anita B; Radiloff, Daniel R; Liu, Irwin M; Wakeman, Timothy P; Fielhauer, Jeffrey R; Foster, Erika H; Lathia, Justin D; Rich, Jeremy N; Wang, Xiao-Fan; Datto, Michael B. NDRG4 is required for cell cycle progression and survival in glioblastoma cells. The Journal Of Biological Chemistry. 2009;284(37):25160-9. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.