Anti NAA35 pAb (ATL-HPA021547)

Atlas Antibodies

Catalog No.: ATL-HPA021547-25

Protein Description: N(alpha)-acetyltransferase 35, NatC auxiliary subunit
Gene Name: NAA35
Alternative Gene Name: bA379P1.1, FLJ21613, FLJ22643, MAK10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021555: 100%, ENSRNOG00000018417: 98%
Entrez Gene ID: 60560
Uniprot ID: Q5VZE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQ
• Gene Sequence: KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQ
• Gene ID - Mouse: ENSMUSG00000021555
• Gene ID - Rat: ENSRNOG00000018417
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NAA35 pAb (ATL-HPA021547) – 2 Found

Osberg, Camilla; Aksnes, Henriette; Ninzima, Sandra; Marie, Michaël; Arnesen, Thomas. Microscopy-based Saccharomyces cerevisiae complementation model reveals functional conservation and redundancy of N-terminal acetyltransferases. Scientific Reports. 2016;6( 27555049):31627. 

Van Damme, Petra; Kalvik, Thomas V; Starheim, Kristian K; Jonckheere, Veronique; Myklebust, Line M; Menschaert, Gerben; Varhaug, Jan Erik; Gevaert, Kris; Arnesen, Thomas. A Role for Human N-alpha Acetyltransferase 30 (Naa30) in Maintaining Mitochondrial Integrity. Molecular & Cellular Proteomics : Mcp. 2016;15(11):3361-3372.