Anti MYT1 pAb (ATL-HPA006303)

Atlas Antibodies

Catalog No.: ATL-HPA006303-25

Protein Description: myelin transcription factor 1
Gene Name: MYT1
Alternative Gene Name: MTF1, MYTI, NZF2, PLPB1, ZC2HC4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010505: 84%, ENSRNOG00000017346: 81%
Entrez Gene ID: 4661
Uniprot ID: Q01538
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPLDT
• Gene Sequence: EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPLDT
• Gene ID - Mouse: ENSMUSG00000010505
• Gene ID - Rat: ENSRNOG00000017346
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYT1 pAb (ATL-HPA006303) – 3 Found

Chandrasekar, Vijay; Dreyer, Jean-Luc. The brain-specific Neural Zinc Finger transcription factor 2b (NZF-2b/7ZFMyt1) causes suppression of cocaine-induced locomotor activity. Neurobiology Of Disease. 2010;37(1):86-98. 

Chandrasekar, Vijay; Dreyer, Jean-Luc. The Brain-Specific Neural Zinc Finger Transcription Factor 2b (NZF-2b/7ZFMyt1) Suppresses Cocaine Self-Administration in Rats. Frontiers In Behavioral Neuroscience. 4( 20407577):14. 

Islam, Mohammed M; Smith, Derek K; Niu, Wenze; Fang, Sanhua; Iqbal, Nida; Sun, Guoqiang; Shi, Yanhong; Zhang, Chun-Li. Enhancer Analysis Unveils Genetic Interactions between TLX and SOX2 in Neural Stem Cells and In Vivo Reprogramming. Stem Cell Reports. 2015;5(5):805-815.