Anti MYO1B pAb (ATL-HPA013607)

Atlas Antibodies

Catalog No.: ATL-HPA013607-25

Protein Description: myosin IB
Gene Name: MYO1B
Alternative Gene Name: myr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018417: 95%, ENSRNOG00000048152: 94%
Entrez Gene ID: 4430
Uniprot ID: O43795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLNKLKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVA
• Gene Sequence: LLNKLKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVA
• Gene ID - Mouse: ENSMUSG00000018417
• Gene ID - Rat: ENSRNOG00000048152
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYO1B pAb (ATL-HPA013607) – 5 Found

Rozbicki, Emil; Chuai, Manli; Karjalainen, Antti I; Song, Feifei; Sang, Helen M; Martin, René; Knölker, Hans-Joachim; MacDonald, Michael P; Weijer, Cornelis J. Myosin-II-mediated cell shape changes and cell intercalation contribute to primitive streak formation. Nature Cell Biology. 2015;17(4):397-408. 

Komaba, Shigeru; Coluccio, Lynne M. Myosin 1b Regulates Amino Acid Transport by Associating Transporters with the Apical Plasma Membrane of Kidney Cells. Plos One. 10(9):e0138012. 

Yamada, Yasutaka; Koshizuka, Keiichi; Hanazawa, Toyoyuki; Kikkawa, Naoko; Okato, Atsushi; Idichi, Tetsuya; Arai, Takayuki; Sugawara, Sho; Katada, Koji; Okamoto, Yoshitaka; Seki, Naohiko. Passenger strand of miR-145-3p acts as a tumor-suppressor by targeting MYO1B in head and neck squamous cell carcinoma. International Journal Of Oncology. 2018;52(1):166-178. 

Zhou, Xuexia; Wang, Run; Li, Xuebing; Yu, Lin; Hua, Dan; Sun, Cuiyun; Shi, Cuijuan; Luo, Wenjun; Rao, Chun; Jiang, Zhendong; Feng, Ying; Wang, Qian; Yu, Shizhu. Splicing factor SRSF1 promotes gliomagenesis via oncogenic splice-switching of MYO1B. The Journal Of Clinical Investigation. 2019;129(2):676-693. 

Makowska, Katarzyna A; Hughes, Ruth E; White, Kathryn J; Wells, Claire M; Peckham, Michelle. Specific Myosins Control Actin Organization, Cell Morphology, and Migration in Prostate Cancer Cells. Cell Reports. 2015;13(10):2118-25.