Anti MSRA pAb (ATL-HPA023804)

Atlas Antibodies

Catalog No.: ATL-HPA023804-100

Protein Description: methionine sulfoxide reductase A
Gene Name: MSRA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054733: 85%, ENSRNOG00000012440: 84%
Entrez Gene ID: 4482
Uniprot ID: Q9UJ68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
• Gene Sequence: ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
• Gene ID - Mouse: ENSMUSG00000054733
• Gene ID - Rat: ENSRNOG00000012440
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.