Anti MSRA pAb (ATL-HPA023804)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023804-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: MSRA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054733: 85%, ENSRNOG00000012440: 84%
Entrez Gene ID: 4482
Uniprot ID: Q9UJ68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG |
| Gene Sequence | ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG |
| Gene ID - Mouse | ENSMUSG00000054733 |
| Gene ID - Rat | ENSRNOG00000012440 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MSRA pAb (ATL-HPA023804) | |
| Datasheet | Anti MSRA pAb (ATL-HPA023804) Datasheet (External Link) |
| Vendor Page | Anti MSRA pAb (ATL-HPA023804) at Atlas Antibodies |
| Documents & Links for Anti MSRA pAb (ATL-HPA023804) | |
| Datasheet | Anti MSRA pAb (ATL-HPA023804) Datasheet (External Link) |
| Vendor Page | Anti MSRA pAb (ATL-HPA023804) |