Anti MRPS6 pAb (ATL-HPA007861)

Atlas Antibodies

Catalog No.: ATL-HPA007861-25

Protein Description: mitochondrial ribosomal protein S6
Gene Name: MRPS6
Alternative Gene Name: C21orf101, MRP-S6, RPMS6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039680: 83%, ENSRNOG00000059381: 85%
Entrez Gene ID: 64968
Uniprot ID: P82932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
• Gene Sequence: KQPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
• Gene ID - Mouse: ENSMUSG00000039680
• Gene ID - Rat: ENSRNOG00000059381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.