Anti MRPS6 pAb (ATL-HPA007861)

Atlas Antibodies

Catalog No.:
ATL-HPA007861-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S6
Gene Name: MRPS6
Alternative Gene Name: C21orf101, MRP-S6, RPMS6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039680: 83%, ENSRNOG00000059381: 85%
Entrez Gene ID: 64968
Uniprot ID: P82932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Gene Sequence KQPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Gene ID - Mouse ENSMUSG00000039680
Gene ID - Rat ENSRNOG00000059381
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS6 pAb (ATL-HPA007861)
Datasheet Anti MRPS6 pAb (ATL-HPA007861) Datasheet (External Link)
Vendor Page Anti MRPS6 pAb (ATL-HPA007861) at Atlas Antibodies

Documents & Links for Anti MRPS6 pAb (ATL-HPA007861)
Datasheet Anti MRPS6 pAb (ATL-HPA007861) Datasheet (External Link)
Vendor Page Anti MRPS6 pAb (ATL-HPA007861)