Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029134-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S10
Gene Name: MRPS10
Alternative Gene Name: FLJ10567
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034729: 89%, ENSRNOG00000022609: 87%
Entrez Gene ID: 55173
Uniprot ID: P82664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEE
Gene Sequence YEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEE
Gene ID - Mouse ENSMUSG00000034729
Gene ID - Rat ENSRNOG00000022609
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation)
Datasheet Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation)
Datasheet Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation)
Citations for Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) – 1 Found
Nouws, Jessica; Goswami, Arvind V; Bestwick, Megan; McCann, Beverly Jo; Surovtseva, Yulia V; Shadel, Gerald S. Mitochondrial Ribosomal Protein L12 Is Required for POLRMT Stability and Exists as Two Forms Generated by Alternative Proteolysis during Import. The Journal Of Biological Chemistry. 2016;291(2):989-97.  PubMed