Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029134-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MRPS10
Alternative Gene Name: FLJ10567
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034729: 89%, ENSRNOG00000022609: 87%
Entrez Gene ID: 55173
Uniprot ID: P82664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEE |
| Gene Sequence | YEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEE |
| Gene ID - Mouse | ENSMUSG00000034729 |
| Gene ID - Rat | ENSRNOG00000022609 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) | |
| Datasheet | Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) | |
| Datasheet | Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) |
| Citations for Anti MRPS10 pAb (ATL-HPA029134 w/enhanced validation) – 1 Found |
| Nouws, Jessica; Goswami, Arvind V; Bestwick, Megan; McCann, Beverly Jo; Surovtseva, Yulia V; Shadel, Gerald S. Mitochondrial Ribosomal Protein L12 Is Required for POLRMT Stability and Exists as Two Forms Generated by Alternative Proteolysis during Import. The Journal Of Biological Chemistry. 2016;291(2):989-97. PubMed |