Anti MRPL12 pAb (ATL-HPA023043)

Atlas Antibodies

Catalog No.: ATL-HPA023043-25

Protein Description: mitochondrial ribosomal protein L12
Gene Name: MRPL12
Alternative Gene Name: MRPL7, MRPL7/L12, RPML12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039640: 86%, ENSRNOG00000036695: 81%
Entrez Gene ID: 6182
Uniprot ID: P52815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGG
• Gene Sequence: PCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGG
• Gene ID - Mouse: ENSMUSG00000039640
• Gene ID - Rat: ENSRNOG00000036695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.