Anti MRPL12 pAb (ATL-HPA022853)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022853-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/85078/155096/atl-hpa022853_anti-mrpl12-pab-atl-hpa022853_36729__09939.1681105612.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MRPL12
Alternative Gene Name: MRPL7, MRPL7/L12, RPML12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039640: 86%, ENSRNOG00000036695: 86%
Entrez Gene ID: 6182
Uniprot ID: P52815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE |
| Gene Sequence | VMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE |
| Gene ID - Mouse | ENSMUSG00000039640 |
| Gene ID - Rat | ENSRNOG00000036695 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPL12 pAb (ATL-HPA022853) | |
| Datasheet | Anti MRPL12 pAb (ATL-HPA022853) Datasheet (External Link) |
| Vendor Page | Anti MRPL12 pAb (ATL-HPA022853) at Atlas Antibodies |
| Documents & Links for Anti MRPL12 pAb (ATL-HPA022853) | |
| Datasheet | Anti MRPL12 pAb (ATL-HPA022853) Datasheet (External Link) |
| Vendor Page | Anti MRPL12 pAb (ATL-HPA022853) |
| Citations for Anti MRPL12 pAb (ATL-HPA022853) – 3 Found |
| Chen, Jiayu; Zheng, Qizhi; Peiffer, Lauren B; Hicks, Jessica L; Haffner, Michael C; Rosenberg, Avi Z; Levi, Moshe; Wang, Xiaoxin X; Ozbek, Busra; Baena-Del Valle, Javier; Yegnasubramanian, Srinivasan; De Marzo, Angelo M. An in Situ Atlas of Mitochondrial DNA in Mammalian Tissues Reveals High Content in Stem and Proliferative Compartments. The American Journal Of Pathology. 2020;190(7):1565-1579. PubMed |
| Busch, Jakob D; Cipullo, Miriam; Atanassov, Ilian; Bratic, Ana; Silva Ramos, Eduardo; Schöndorf, Thomas; Li, Xinping; Pearce, Sarah F; Milenkovic, Dusanka; Rorbach, Joanna; Larsson, Nils-Göran. MitoRibo-Tag Mice Provide a Tool for In Vivo Studies of Mitoribosome Composition. Cell Reports. 2019;29(6):1728-1738.e9. PubMed |
| Clemente, Paula; Calvo-Garrido, Javier; Pearce, Sarah F; Schober, Florian A; Shigematsu, Megumi; Siira, Stefan J; Laine, Isabelle; Spåhr, Henrik; Steinmetzger, Christian; Petzold, Katja; Kirino, Yohei; Wibom, Rolf; Rackham, Oliver; Filipovska, Aleksandra; Rorbach, Joanna; Freyer, Christoph; Wredenberg, Anna. ANGEL2 phosphatase activity is required for non-canonical mitochondrial RNA processing. Nature Communications. 2022;13(1):5750. PubMed |