Anti MRM3 pAb (ATL-HPA022534 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022534-25

Protein Description: mitochondrial rRNA methyltransferase 3
Gene Name: MRM3
Alternative Gene Name: FLJ10581, HC90, RMTL1, RNMTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038046: 76%, ENSRNOG00000037238: 79%
Entrez Gene ID: 55178
Uniprot ID: Q9HC36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRKAPSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPGDRRLSSVMTIVKSRPFRE
• Gene Sequence: WDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRKAPSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPGDRRLSSVMTIVKSRPFRE
• Gene ID - Mouse: ENSMUSG00000038046
• Gene ID - Rat: ENSRNOG00000037238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.