Anti MLPH pAb (ATL-HPA014685)

Atlas Antibodies

Catalog No.: ATL-HPA014685-25

Protein Description: melanophilin
Gene Name: MLPH
Alternative Gene Name: exophilin-3, l(1)-3Rk, l1Rk3, ln, Slac-2a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026303: 41%, ENSRNOG00000019763: 54%
Entrez Gene ID: 79083
Uniprot ID: Q9BV36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFL
• Gene Sequence: ELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFL
• Gene ID - Mouse: ENSMUSG00000026303
• Gene ID - Rat: ENSRNOG00000019763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MLPH pAb (ATL-HPA014685) – 3 Found

Zhan, Cheng; Yan, Li; Wang, Lin; Sun, Yang; Wang, Xingxing; Lin, Zongwu; Zhang, Yongxing; Shi, Yu; Jiang, Wei; Wang, Qun. Identification of immunohistochemical markers for distinguishing lung adenocarcinoma from squamous cell carcinoma. Journal Of Thoracic Disease. 2015;7(8):1398-405. 

Gromov, Pavel; Espinoza, Jaime A; Talman, Maj-Lis; Honma, Naoko; Kroman, Niels; Timmermans Wielenga, Vera; Moreira, José M A; Gromova, Irina. FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast. Plos One. 9(11):e112024. 

Bu, Huajie; Narisu, Narisu; Schlick, Bettina; Rainer, Johannes; Manke, Thomas; Schäfer, Georg; Pasqualini, Lorenza; Chines, Peter; Schweiger, Michal R; Fuchsberger, Christian; Klocker, Helmut. Putative Prostate Cancer Risk SNP in an Androgen Receptor-Binding Site of the Melanophilin Gene Illustrates Enrichment of Risk SNPs in Androgen Receptor Target Sites. Human Mutation. 2016;37(1):52-64.