Anti MINPP1 pAb (ATL-HPA026859)

Atlas Antibodies

Catalog No.:
ATL-HPA026859-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: multiple inositol-polyphosphate phosphatase 1
Gene Name: MINPP1
Alternative Gene Name: MIPP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024896: 83%, ENSRNOG00000011287: 82%
Entrez Gene ID: 9562
Uniprot ID: Q9UNW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGL
Gene Sequence LVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGL
Gene ID - Mouse ENSMUSG00000024896
Gene ID - Rat ENSRNOG00000011287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MINPP1 pAb (ATL-HPA026859)
Datasheet Anti MINPP1 pAb (ATL-HPA026859) Datasheet (External Link)
Vendor Page Anti MINPP1 pAb (ATL-HPA026859) at Atlas Antibodies

Documents & Links for Anti MINPP1 pAb (ATL-HPA026859)
Datasheet Anti MINPP1 pAb (ATL-HPA026859) Datasheet (External Link)
Vendor Page Anti MINPP1 pAb (ATL-HPA026859)
Citations for Anti MINPP1 pAb (ATL-HPA026859) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed