Anti MGLL pAb (ATL-HPA011994)

Atlas Antibodies

Catalog No.:
ATL-HPA011994-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: monoglyceride lipase
Gene Name: MGLL
Alternative Gene Name: HU-K5, MGL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033174: 84%, ENSRNOG00000014508: 82%
Entrez Gene ID: 11343
Uniprot ID: Q99685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM
Gene Sequence RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM
Gene ID - Mouse ENSMUSG00000033174
Gene ID - Rat ENSRNOG00000014508
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MGLL pAb (ATL-HPA011994)
Datasheet Anti MGLL pAb (ATL-HPA011994) Datasheet (External Link)
Vendor Page Anti MGLL pAb (ATL-HPA011994) at Atlas Antibodies

Documents & Links for Anti MGLL pAb (ATL-HPA011994)
Datasheet Anti MGLL pAb (ATL-HPA011994) Datasheet (External Link)
Vendor Page Anti MGLL pAb (ATL-HPA011994)