Anti MGLL pAb (ATL-HPA011348)

Atlas Antibodies

Catalog No.: ATL-HPA011348-100

Protein Description: monoglyceride lipase
Gene Name: MGLL
Alternative Gene Name: HU-K5, MGL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033174: 84%, ENSRNOG00000014508: 82%
Entrez Gene ID: 11343
Uniprot ID: Q99685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM
• Gene Sequence: RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM
• Gene ID - Mouse: ENSMUSG00000033174
• Gene ID - Rat: ENSRNOG00000014508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MGLL pAb (ATL-HPA011348) – 1 Found

Yang, Xuejun; Zhang, Dongmei; Liu, Sha; Li, Xiaojie; Hu, Wanglai; Han, Chuanchun. KLF4 suppresses the migration of hepatocellular carcinoma by transcriptionally upregulating monoglyceride lipase. American Journal Of Cancer Research. 8(6):1019-1029.