Anti METTL22 pAb (ATL-HPA040803)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040803-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: METTL22
Alternative Gene Name: C16orf68, FLJ12433, MGC2654
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039345: 83%, ENSRNOG00000002714: 83%
Entrez Gene ID: 79091
Uniprot ID: Q9BUU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVPFSWSQEEISDLYDHTTILFAAEVFYDDDLTDAVFKTLSR |
| Gene Sequence | RNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVPFSWSQEEISDLYDHTTILFAAEVFYDDDLTDAVFKTLSR |
| Gene ID - Mouse | ENSMUSG00000039345 |
| Gene ID - Rat | ENSRNOG00000002714 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti METTL22 pAb (ATL-HPA040803) | |
| Datasheet | Anti METTL22 pAb (ATL-HPA040803) Datasheet (External Link) |
| Vendor Page | Anti METTL22 pAb (ATL-HPA040803) at Atlas Antibodies |
| Documents & Links for Anti METTL22 pAb (ATL-HPA040803) | |
| Datasheet | Anti METTL22 pAb (ATL-HPA040803) Datasheet (External Link) |
| Vendor Page | Anti METTL22 pAb (ATL-HPA040803) |