Anti MCPH1 pAb (ATL-HPA008238)

Atlas Antibodies

Catalog No.: ATL-HPA008238-25

Protein Description: microcephalin 1
Gene Name: MCPH1
Alternative Gene Name: BRIT1, FLJ12847
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039842: 55%, ENSRNOG00000028586: 52%
Entrez Gene ID: 79648
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGI
• Gene Sequence: AVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGI
• Gene ID - Mouse: ENSMUSG00000039842
• Gene ID - Rat: ENSRNOG00000028586
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MCPH1 pAb (ATL-HPA008238) – 1 Found

Venkatesh, Thejaswini; Nagashri, Mathighatta Nagaraj; Swamy, Shivananda S; Mohiyuddin, S M Azeem; Gopinath, Kodaganur S; Kumar, Arun. Primary microcephaly gene MCPH1 shows signatures of tumor suppressors and is regulated by miR-27a in oral squamous cell carcinoma. Plos One. 8(3):e54643.