Anti MAGED4B pAb (ATL-HPA003554)

Atlas Antibodies

Catalog No.: ATL-HPA003554-25

Protein Description: melanoma antigen family D4B
Gene Name: MAGED4B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022422: 25%, ENSRNOG00000002882: 26%
Entrez Gene ID: 81557
Uniprot ID: Q96JG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEGSFSVQSESYSVEDMDEGSDEVGEEEMVEGNDYEEFGAFGGYGTLTSFDIHILRAFGSLGPGLRILSNEPWELENPVLAQTLVEALQLDPETLANETAARAANVARAAASNRAA
• Gene Sequence: AEGSFSVQSESYSVEDMDEGSDEVGEEEMVEGNDYEEFGAFGGYGTLTSFDIHILRAFGSLGPGLRILSNEPWELENPVLAQTLVEALQLDPETLANETAARAANVARAAASNRAA
• Gene ID - Mouse: ENSMUSG00000022422
• Gene ID - Rat: ENSRNOG00000002882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAGED4B pAb (ATL-HPA003554) – 1 Found

Chai, San Jiun; Fong, Sammuel Chee Yong; Gan, Chai Phei; Pua, Kin Choo; Lim, Paul Vey Hong; Lau, Shin Hin; Zain, Rosnah Binti; Abraham, Thomas; Ismail, Siti Mazlipah; Abdul Rahman, Zainal Ariff; Ponniah, Sathibalan; Patel, Vyomesh; Cheong, Sok Ching; Lim, Kue Peng. In vitro evaluation of dual-antigenic PV1 peptide vaccine in head and neck cancer patients. Human Vaccines & Immunotherapeutics. 15(1):167-178.