Anti LDOC1L pAb (ATL-HPA005697)

Atlas Antibodies

Catalog No.: ATL-HPA005697-25

Protein Description: leucine zipper, down-regulated in cancer 1-like
Gene Name: LDOC1L
Alternative Gene Name: dJ1033E15.2, DKFZp761O17121, Mar6, Mart6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055745: 98%, ENSRNOG00000021671: 98%
Entrez Gene ID: 84247
Uniprot ID: Q6ICC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGF
• Gene Sequence: SVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGF
• Gene ID - Mouse: ENSMUSG00000055745
• Gene ID - Rat: ENSRNOG00000021671
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.