Anti KLHDC8B pAb (ATL-HPA008463)

Atlas Antibodies

Catalog No.: ATL-HPA008463-100

Protein Description: kelch domain containing 8B
Gene Name: KLHDC8B
Alternative Gene Name: MGC35097
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032609: 98%, ENSRNOG00000047867: 99%
Entrez Gene ID: 200942
Uniprot ID: Q8IXV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALG
• Gene Sequence: GTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWLALAPLPTARAGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALG
• Gene ID - Mouse: ENSMUSG00000032609
• Gene ID - Rat: ENSRNOG00000047867
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.