Anti KLHDC10 pAb (ATL-HPA020119)

Atlas Antibodies

Catalog No.:
ATL-HPA020119-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: kelch domain containing 10
Gene Name: KLHDC10
Alternative Gene Name: KIAA0265, slim
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029775: 99%, ENSRNOG00000010267: 99%
Entrez Gene ID: 23008
Uniprot ID: Q6PID8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK
Gene Sequence EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK
Gene ID - Mouse ENSMUSG00000029775
Gene ID - Rat ENSRNOG00000010267
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLHDC10 pAb (ATL-HPA020119)
Datasheet Anti KLHDC10 pAb (ATL-HPA020119) Datasheet (External Link)
Vendor Page Anti KLHDC10 pAb (ATL-HPA020119) at Atlas Antibodies

Documents & Links for Anti KLHDC10 pAb (ATL-HPA020119)
Datasheet Anti KLHDC10 pAb (ATL-HPA020119) Datasheet (External Link)
Vendor Page Anti KLHDC10 pAb (ATL-HPA020119)
Citations for Anti KLHDC10 pAb (ATL-HPA020119) – 1 Found
Pankow, Sandra; Bamberger, Casimir; Calzolari, Diego; Martínez-Bartolomé, Salvador; Lavallée-Adam, Mathieu; Balch, William E; Yates, John R 3rd. ∆F508 CFTR interactome remodelling promotes rescue of cystic fibrosis. Nature. 2015;528(7583):510-6.  PubMed