Anti KLHDC10 pAb (ATL-HPA020119)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020119-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KLHDC10
Alternative Gene Name: KIAA0265, slim
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029775: 99%, ENSRNOG00000010267: 99%
Entrez Gene ID: 23008
Uniprot ID: Q6PID8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK |
| Gene Sequence | EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK |
| Gene ID - Mouse | ENSMUSG00000029775 |
| Gene ID - Rat | ENSRNOG00000010267 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KLHDC10 pAb (ATL-HPA020119) | |
| Datasheet | Anti KLHDC10 pAb (ATL-HPA020119) Datasheet (External Link) |
| Vendor Page | Anti KLHDC10 pAb (ATL-HPA020119) at Atlas Antibodies |
| Documents & Links for Anti KLHDC10 pAb (ATL-HPA020119) | |
| Datasheet | Anti KLHDC10 pAb (ATL-HPA020119) Datasheet (External Link) |
| Vendor Page | Anti KLHDC10 pAb (ATL-HPA020119) |
| Citations for Anti KLHDC10 pAb (ATL-HPA020119) – 1 Found |
| Pankow, Sandra; Bamberger, Casimir; Calzolari, Diego; Martínez-Bartolomé, Salvador; Lavallée-Adam, Mathieu; Balch, William E; Yates, John R 3rd. ∆F508 CFTR interactome remodelling promotes rescue of cystic fibrosis. Nature. 2015;528(7583):510-6. PubMed |