Anti KLHDC1 pAb (ATL-HPA020461)

Atlas Antibodies

Catalog No.:
ATL-HPA020461-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: kelch domain containing 1
Gene Name: KLHDC1
Alternative Gene Name: MST025
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051890: 89%, ENSRNOG00000004425: 88%
Entrez Gene ID: 122773
Uniprot ID: Q8N7A1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLCGGLSADNIPLSDGWIHNVTTNCWKQLTHLPKTRPRLWHTACLGKENEIMVFGGSKDDLLALDTGHCNDLLIFQTQPYSLLRSCLDCIGKNSIMLESQISLLPPKLLQQVLKKITFWAAANHREEQRVQ
Gene Sequence FLCGGLSADNIPLSDGWIHNVTTNCWKQLTHLPKTRPRLWHTACLGKENEIMVFGGSKDDLLALDTGHCNDLLIFQTQPYSLLRSCLDCIGKNSIMLESQISLLPPKLLQQVLKKITFWAAANHREEQRVQ
Gene ID - Mouse ENSMUSG00000051890
Gene ID - Rat ENSRNOG00000004425
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLHDC1 pAb (ATL-HPA020461)
Datasheet Anti KLHDC1 pAb (ATL-HPA020461) Datasheet (External Link)
Vendor Page Anti KLHDC1 pAb (ATL-HPA020461) at Atlas Antibodies

Documents & Links for Anti KLHDC1 pAb (ATL-HPA020461)
Datasheet Anti KLHDC1 pAb (ATL-HPA020461) Datasheet (External Link)
Vendor Page Anti KLHDC1 pAb (ATL-HPA020461)