Anti KCNC4 pAb (ATL-HPA014740)

Atlas Antibodies

Catalog No.:
ATL-HPA014740-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium voltage-gated channel, Shaw-related subfamily, member 4
Gene Name: KCNC4
Alternative Gene Name: C1orf30, HKSHIIIC, Kv3.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027895: 100%, ENSRNOG00000060988: 96%
Entrez Gene ID: 3749
Uniprot ID: Q03721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD
Gene Sequence ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD
Gene ID - Mouse ENSMUSG00000027895
Gene ID - Rat ENSRNOG00000060988
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNC4 pAb (ATL-HPA014740)
Datasheet Anti KCNC4 pAb (ATL-HPA014740) Datasheet (External Link)
Vendor Page Anti KCNC4 pAb (ATL-HPA014740) at Atlas Antibodies

Documents & Links for Anti KCNC4 pAb (ATL-HPA014740)
Datasheet Anti KCNC4 pAb (ATL-HPA014740) Datasheet (External Link)
Vendor Page Anti KCNC4 pAb (ATL-HPA014740)