Anti ITGA8 pAb (ATL-HPA003432)

Atlas Antibodies

Catalog No.: ATL-HPA003432-25

Protein Description: integrin, alpha 8
Gene Name: ITGA8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026768: 91%, ENSRNOG00000016538: 91%
Entrez Gene ID: 8516
Uniprot ID: P53708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
• Gene Sequence: HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
• Gene ID - Mouse: ENSMUSG00000026768
• Gene ID - Rat: ENSRNOG00000016538
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITGA8 pAb (ATL-HPA003432) – 2 Found

Talbot, Jared Coffin; Nichols, James T; Yan, Yi-Lin; Leonard, Isaac F; BreMiller, Ruth A; Amacher, Sharon L; Postlethwait, John H; Kimmel, Charles B. Pharyngeal morphogenesis requires fras1-itga8-dependent epithelial-mesenchymal interaction. Developmental Biology. 2016;416(1):136-148. 

Fukuzawa, Ryuji; Anaka, Matthew R; Morison, Ian M; Reeve, Anthony E. The developmental programme for genesis of the entire kidney is recapitulated in Wilms tumour. Plos One. 12(10):e0186333.