Anti IQCK pAb (ATL-HPA026792 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA026792-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: IQ motif containing K
Gene Name: IQCK
Alternative Gene Name: FLJ36575, MGC35048
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073856: 89%, ENSRNOG00000036758: 89%
Entrez Gene ID: 124152
Uniprot ID: Q8N0W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQ
Gene Sequence ERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQ
Gene ID - Mouse ENSMUSG00000073856
Gene ID - Rat ENSRNOG00000036758
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IQCK pAb (ATL-HPA026792 w/enhanced validation)
Datasheet Anti IQCK pAb (ATL-HPA026792 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IQCK pAb (ATL-HPA026792 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti IQCK pAb (ATL-HPA026792 w/enhanced validation)
Datasheet Anti IQCK pAb (ATL-HPA026792 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IQCK pAb (ATL-HPA026792 w/enhanced validation)
Citations for Anti IQCK pAb (ATL-HPA026792 w/enhanced validation) – 1 Found
Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244.  PubMed